SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000078459 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000078459
Domain Number 1 Region: 148-307,338-386,429-478
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.54e-50
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 
Domain Number 2 Region: 594-733
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.53e-19
Family Glycerol-3-phosphate transporter 0.017
Further Details:      
 
Domain Number 3 Region: 502-583
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000275
Family Pentapeptide repeats 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000078459   Gene: ENSDARG00000059997   Transcript: ENSDART00000084024
Sequence length 745
Comment pep:novel chromosome:Zv9:5:47601153:47677665:1 gene:ENSDARG00000059997 transcript:ENSDART00000084024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDETAPQDTSSLMKGARDIAKVAKKQAVKKVNKVVDRASDEYSQNRAYQRFQDEDDDYYS
QPDGNYTSHQANDEEGSSDATEGHDDEDEIYEGEYQGIPSDAKARDGQVALGQPLSDGLK
DRRELENERQADEEELAQQYELIIQECGHGRFQWQLFFTLGLALMSDGVEVFVVGFVLPS
AETDMCVPDSSSGWLGSIVYLGMMVGAFFWGGMADKVGRRQCLLICMSLNGFFAFLSSFV
QGYGLFLLCRMIAGFGIGGAVPIVFSYFAEVLAREKRGEHLSWLCMFWMIGEIYASAMAW
AIIPHYGQITTASSQFINYHHYTSWSFSMGSAYQFHSWRVFVVVCALPCVCAVVALTFMP
ESPRFYLEVGKHDEAWMILKQIHDTNMRARGQPEKVFTVNRIKIPKQIDEFVEMHESGNF
FSKAIFRIKTELHGIWLNFLKCFNYPVKESTVKLAIVWLTLSFGYYGLSVWFPDVIKHLQ
NDEYASKGQRHNNERIEDFTFNFTLENQIHTNSLFINDRFINMKFKSVTFINSTFQSCFF
EDVTSVGSFFRNCTFIEAVFYNTDIDDSKLKNTDVINSTFYHNKTGCQMTFEDDYSAYWV
YFVNFLGTLAVLPGNIVSALLMDKIGRLSMLGFSMILSGISCFFLWFGTSESMMIGMLCL
YNGLSISAWNSLDVVTTELYPTDRRGTGFGFCNALCKLAAVMGNLIFGSLVGITKAIPIL
LASSVLVGGGLVGLRLPDTRSNVLM
Download sequence
Identical sequences A2CF25
ENSDARP00000078459 NP_001121811.1.45394 ENSDARP00000078459 7955.ENSDARP00000078459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]