SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000078788 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000078788
Domain Number 1 Region: 79-254
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-42
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 229-350
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.39e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000078788   Gene: ENSDARG00000060096   Transcript: ENSDART00000084353
Sequence length 479
Comment pep:known chromosome:Zv9:10:7557850:7596243:1 gene:ENSDARG00000060096 transcript:ENSDART00000084353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLHAGNGVHWKDGKSQRGTADGLAEQESSSRGSDSELNGFANTEVQPDKYGFIGGAQQ
TAGENSDDIPPDVLRQREAKWLDMLNNWDKWMAKKHKKVKLRCQKGIPPSLRGRAWLYLS
GGKVKKEQNPGKFKELDSQPGDPKWLDVIEKDLHRQFPFHEMFVARGGHGQQDLFRVLKA
YTLHRPEEGYCQAQAPIAAVLLMHMPAEDAFWGLVQICEKYLPGYYSAGLEAIQLDGEIL
FALLKRVSPVAHRHLKKYKIDPILYMTEWFMCAFSRTLPWASVLRVWDMFFCEGVKIIFR
VGLVLLKCMLGSPEKLKACQGQYETMELLRSIEPRYMQEAFLVQEVIDLPVSERDIEKEH
LSQLRRWKETHGELHCKSPPRMQGAKAIMAAEPPSRKDLKQNPTIIVEAAESQTETGKKA
KKSKTEKRKETQSSLPPLNPYPLPSDNHLSPSGTQPLQKHGPLQASNQSLSSAEQDTYL
Download sequence
Identical sequences F1Q602
ENSDARP00000078788 ENSDARP00000078788 XP_691101.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]