SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000080162 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000080162
Domain Number 1 Region: 686-968
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.62e-70
Family Tandem AAA-ATPase domain 0.0000278
Further Details:      
 
Domain Number 2 Region: 420-684
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.72e-56
Family Tandem AAA-ATPase domain 0.000037
Further Details:      
 
Domain Number 3 Region: 260-352
Classification Level Classification E-value
Superfamily Chromo domain-like 1.1e-22
Family Chromo domain 0.0000101
Further Details:      
 
Domain Number 4 Region: 355-432
Classification Level Classification E-value
Superfamily Chromo domain-like 5.89e-20
Family Chromo domain 0.0000134
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000080162
Domain Number - Region: 1242-1275
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00458
Family DNA-binding domain of telomeric protein 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000080162   Gene: ENSDARG00000014878   Transcript: ENSDART00000085727
Sequence length 1778
Comment pep:known_by_projection chromosome:Zv9:10:8523589:8589277:1 gene:ENSDARG00000014878 transcript:ENSDART00000085727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRSEDESVSNSSGESSNSDDESGSGSGSGSGSSSSSSSSSSSQSGSSDSGSGSDSGSQ
SDSDSEKSKEKNDQDNKIDGAAFWNSNPSILTVQRTAMLRKQQIQQQQLQQQSSSNTGSD
EDSSSSDESDDDSKSRSKGSGSDSDSGSGSGSGSSDSSAEEEANSDESVSDYEPSHKVKS
RKPSNKANARNGRNNKAPKKKPSHSSSDDEDDYKKALAGPRRQATVNVSYKEDEELKTDS
DDLVEVCGEDVPPPEEDEFETLERVMEMRIGRKGVTGAVTTVYAVEADGDPNANFDPNRQ
PGEVQYLIKWKNWSHIHNTWETEETLKQQNVKGMKKLDNFKKKEQEKKKWLKAASPEDVE
YFNCQQELMDDLHSQYQLVERIIGHSNQKSAAGYPDYLCKWQGLPYSECSWEDGALISKK
FQKCIDEYMSRNQCKTIPSRDCKVLKQRPRFVPMKKQPHYIGGEGLELRDYQLDGLNWMA
HSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQLWA
PLMNVVVYLGDINSRNMIRTHEWMHPQTKRLKLNILLTTYEILLKDKSFLGNVSWAFIGV
DEAHRLKNDDSLLYKTMIEFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFHSWEMFEE
EHGKGRDSGYTSLHKELEPFLLRRVKKDVEKSLPAKVEQILRVEMSAVQKQYYKWILTRN
YKALSKGTKGSTSGFLNIMMELKKCCNHCYLIKPPDDNEFYNRQEGLQHLVRSSGKLILL
DKLLVRLKERGHRVLIFSQMVRMLDILAEYLKYRQFLFQRLDGSIKGEMRKQALDHFNAD
GSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLV
TKGSVEEEIIERAKKKMVLDHLVIQRMDTTGKTVLHTGAAPSSSTPFNKEELSAILKFGA
EELFKEPEGEEQEPQEMDIDEILKRAETRENDPGPSTVGEELLSQFKVANFSMMEDEEID
MDTERNDRNWDDIIPEDHRRRLEEEERQKELAEIYLLPRMRKCAKQQMNFNGNEGRRSRN
RRYSASDSDSVSDRKRPKKRGRPRTIPRENIKGFTDAEIRRFIKSYKKFGGPLERLDAIA
RDAELVDKSEHDLRRLAETVHNGCLRTLKENPCGPERTSGGRRGKVKGPTFRISGVQVNA
KLVISHEEELAPLHKAIPADPEERKRYIIPCHSKAAHFDIEWGKEDDSSLLIGIYEYGYG
SWEMIKMDPDLNLTHKLLPDDPDKKPQAKQLQTRADYLIKLLSKDLAKKEAQKQAGTAKS
RNRKPRGKKNKAVKPKMEDVTNSLSSAPPSDKSSDEEDEKDEEDKETPPPVKLPNRRARV
PERTVMEEEDDSDEDELEDAAPVEKDTPEKVVKKEVKKEKKEEGRDSKEREVKEKEIKPE
PLQREDDSPAEAVDIKAEKADTPVHTPTGGDAIPLSEESEELDQKTFSVCKERMRPVKAA
LKQLDRPEKGLSEREQLEHTRQCLIKIGDHITECLREYTNPEQIKQWRKNLWIFVSKFTE
FDARKLHKLYKHAIKKRQENAQAAEQNTSTVNTQSFKHADVERLKESQQDESSRDSYSSD
RHHSSRYHEHSKEHHASDSYRKSSDSRKRPYSSFSNGKDHRERERDQYRERGERPDSRYY
SESKHRKLDEHRSSREHRSESNSKDRTHSEHRFHSEHRSGSSDYSHHKSSRDYRYHSDWQ
MEHRSPRDQRSPIGHRSPFEYSSDHKSTPEQVWSGRKT
Download sequence
Identical sequences A0A0R4IHD7
XP_009303375.1.45394 ENSDARP00000080162 ENSDARP00000080162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]