SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000080170 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000080170
Domain Number 1 Region: 697-979
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-67
Family Tandem AAA-ATPase domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 426-695
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.04e-57
Family Tandem AAA-ATPase domain 0.0000367
Further Details:      
 
Domain Number 3 Region: 274-365
Classification Level Classification E-value
Superfamily Chromo domain-like 5.5e-21
Family Chromo domain 0.0000414
Further Details:      
 
Domain Number 4 Region: 369-443
Classification Level Classification E-value
Superfamily Chromo domain-like 1.25e-19
Family Chromo domain 0.0000521
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000080170
Domain Number - Region: 1254-1285
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00767
Family Homeodomain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000080170   Gene: ENSDARG00000060687   Transcript: ENSDART00000085735
Sequence length 1694
Comment pep:known chromosome:Zv9:18:24722387:24772356:-1 gene:ENSDARG00000060687 transcript:ENSDART00000085735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKNKSKKQEDEGSTQSNASSNSASEESNRSGSESGSQSESEQGSEKAQSRHSESNSTSD
SESHSESGSESNGSKSHQSSAQVKDKPVRKKDNLADVKKVHKKMWEEHPDVYGVRRSSRS
RQEPARLNIGAEGSSDSEGESSKRKSSRQKKKENTWKDDDSNDEEDVEEETSSSESEQEE
KKVRSRRLPARRPQTKSSASKQSQKGRKQRKQESSDEDDDDDDDDEEDTPKRQTRRRAAT
KVSYKEDQNDFETDSDDLIEMAEGAEEQQDDDSETIEKVVDTRTGKKGATGASTTLYAIE
ENGDPGADFDPEKEEGETQFLIKWKGWSYIHNTWESVDSLTQQKVKGMKKLENFKKKNEE
LNAWLKKASPEDLEYYNCQQELTNDLSKQFQIIERVIAHKSSSGEPEYLCKWMGLPYAEC
TWEDSALIKKKFQACIDSFHNRNSSKTVPSKDCKVLKQRPRFVPLKKQPSYIGDENLELR
DYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFIVVVPLSTL
TSWQREFDTWAPDMNVVVYLGDVTSRKTIRDYEWINPQTKRIKFNALLTTYEILLKDKGV
LGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKELWSLLHFLMS
DKFESWEDFEDEHGKGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQILRVDMSAQQ
KQFYKWILTRNFKALSKGTRGSSSGFLNIVMELKKCCNHAFLIKQPEDGENDAPQEHLQS
LVRGGGKLVLLDKLLTRLKDRGNRVLIFSQMVRMLDILADYLSMKRYQFQRLDGSIKGEL
RKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIG
QKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNSSANSNSNPFNK
EELSAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAETRESDQGSSATDELLSQFKVAN
FTMDESTPDLDEKPGRDWDEIIPEEQRRKVEEEQKQKEMEDIYMLPRSRSSNKKAQANDS
DSDVGSKLKHRSSGSDSETDDSEDDKRPKRRGRPRARKNNVEGFTDAEIRRFIKAYKKFG
APLERLEAIARDSELVEKSIADLKRLGELVHNSCVTAVQEHEEHLKENPVEAKGPGKRRG
INIKISGVQVNAKSIIQHEEEFEPLHKAVPSNPAERNKFQLTCRVKTPHFDVDWDIHDDT
QLLLGIYEHGYGNWDLIKTDPDLKLSEKILLDDPEKKPQGKQLQMRTDYLLKMLKKDLES
QDAIKAGDEPKIKKRKPRMKKKAPSNELVNEIASPRLSDNPSEEGEVKDDGAEKTPTKKK
QKKDNKENKEKTGTPKKEKEGDKDKKRSKPKKEKAKPAGKGKKAQGPVHITQGSEPIPIG
EEDDELDQETFSICKERMRPVKKALKQLDKPDEGLSVQDQLQHTRTCLLKIGDRITECLK
SYSDPEHIKIWRRNLWIFVSKFTEFGAQKLHRLYKKAQKKRSQEGEKEHKKKDDPIKKKP
FRPEPSGSSRDSTGAQPTTKPHPPVSHQSGPPHPPHHREQYNQHNKRHFPNDDRGDWQRD
RKYGYPGNSNQPWQGDRHHPYEPHRYKDHHYSDRRPHGDYRSSGGYRNSGSPRKRPYDQY
GNDRDHRGHRDYYD
Download sequence
Identical sequences Q1LVN0
ENSDARP00000080170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]