SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082893 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082893
Domain Number 1 Region: 517-684
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-44
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 2 Region: 659-783
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.32e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 
Domain Number 3 Region: 126-264
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-24
Family Phosphotyrosine-binding domain (PTB) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082893   Gene: ENSDARG00000061757   Transcript: ENSDART00000088460
Sequence length 1043
Comment pep:known_by_projection chromosome:Zv9:22:17536083:17676782:1 gene:ENSDARG00000061757 transcript:ENSDART00000088460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDSSSLGRVSGSTESVSTVTSEEFVLVPPSAGGSPSSSEGRPRLKMSWNGSEQLERAME
EVLDDVADGAGAEQEKGCTQTDFLSTLLKLPHSLTLNNGPLDKTAFVNTSLSVATESSAA
LLESPTVPEEESVQFSKLSYLGCTWVKAPRSETEAQKAMATLRAESAIPIPVILHVPNGS
DGCVRIVDQASGTEIASFPIYKVLFCARGCEGSVESDCFSFTESYRSSEDFQIHVFSCHI
KEAVSRILYSFSTAFKRSAKAATEMQDSPLPLSPDSDVFTFSVSLEVREDDGKGNFSPVP
KDRDKYYFKLRQGVQKKVSVVVQQLNNKELVIERCFGMLLSPGQKVRNSDMHLLDMESMG
KNADGKAYVITGIWNPNTPAFQPLNEDTPKDKQVYMTVAVDLVVTEVVEPVRFLMEALVR
VYPANERFWYFSRKAFCETFYLKLKQGSVKGSQDDMMYEVVSLEKHSECGSQARGRLQSP
TEEEEPEEDSDSEISSGTGDVSKDCPEKILESWGGILNRWQGNLLTRPKGLSALVKPGIP
EALRAEVWQLLSGCHNDQALLEQYRILITKESAQEAVITRDIHRTFPAHDYFKDSGGDGQ
DSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMFNYGLRELYRNNF
EDLHCKFYQLERLLQELLPDLWSHFQELNLEAHMYASQWFLTLFTAKFPLCMVFHITDLL
LCEGLNIIFNVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAAENARRLMEQACNIK
VPTKKLKKFEKEYQSLRESQLQQEDPIDRYQRENRRLQEASMRLEQENDDLAHELVTSKI
ALRNDLDQAEDKADVLNKELLNTKQRLVETEEEKRRQEEETAQLKEVFRRELEKAEQEIK
KTTAIIAEYKQICSQLSTRLEKQQASTKEELDIVKAKVMACERCREVFSKDGPLQIPPVS
QDNRDTDLDEEKDSLKAQLRELELELAQTKLQLVEAKCKIQELEHQRGVLMTEVQAAKNS
WFSKTLGSLKNSASNQSPSSPKE
Download sequence
Identical sequences ENSDARP00000082893 ENSDARP00000082893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]