SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000084038 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000084038
Domain Number 1 Region: 443-617
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 595-732
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-17
Family Ypt/Rab-GAP domain of gyp1p 0.024
Further Details:      
 
Domain Number 3 Region: 761-917
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000382
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000084038   Gene: ENSDARG00000062192   Transcript: ENSDART00000089605
Sequence length 1125
Comment pep:known_by_projection chromosome:Zv9:5:25312629:25344152:-1 gene:ENSDARG00000062192 transcript:ENSDART00000089605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKPEEVLLKNALKLWVTEKSNDYFVLQRRRGYGEDSGGLTGLLVGTLDTVLDSTAKVA
PFRILHQTPDSQVYWTIACGASLEEISQHWDWLQQNIVRTLSVFDSGEDITSFVQGKIRG
LIAEEGTSAGDEEDPERFREAVLRFERLFGLPQREKLVTYFSCSYWRGRVPNQGWIYLST
NFLCFYSYMLGNEVKLVYPWDEVSRLERTSSVLLAESIRVRVRGEDHFFSMLLRLQQTYL
IMQQLADYAIVRFFDKETFHAEHPLANPLHITQRALEIHARNQSFRSFFRLPQEENLCEV
YESFLWVPFSHVNTLGKICVSENYLCFASQDGSQCHLIIPLWEVFSVELPDRSSRALTVC
LRGKRALRFSEVRDFERLAATIRRKCGTLGSPQHCITNPDEEGVMVGQSQAVSTEALMNV
FHPHDAENLDPKMLKERMKEQSWQIHFAEYGRGTGMFCTKKTRDLIVRGVPETLRGELWM
LFSGAVHDMISHPGYYGRLLEDCMGSSSLACDEIERDLHRSLPEHPAFQSDTGISALRRV
LTAYAHRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQ
AVFEELIREHLTQLTEHMTDLSFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAI
LQLGLAVLDYNMDNLLCCNDDAEAVTVLNRFFDSVTNKDSPLPATVQQASATANDKSIQK
VDISDLIKEAYEKYGDIRTEEVENMRKRNKLYVIQTLEDTTKQNVLRVVAQDVKFSASQL
DELYLLFKRQHFVCCYWSVCSPALQNHDPSLPYLDQYQLDQSQFSSLFNLLQPWTTHTHS
RSLARSAFHLLDENGDGLVNFKEFICGLDILYNRSFTEKLKLLFKLHLQPDSAEDGVIRK
CPERGRAKVDLQEYLKQWQEDLQRREENIKDLPRINQVQFISLTKTLYSVFHGDEEEESL
YRAVARVTSLLLRMEEVGRKLQDSSPQKTPQTTPTSTSQPESSPTKPTSPESETPAESRS
THDQPESPVSQHETAPSHSDITPNSTSHPSTPTSSPTETSSPVLDTPTDTPSSPCTVRDG
DWSFSFEQILASLLNEPSVVRFFERVVNTDTLITRARKNQLKDAH
Download sequence
Identical sequences XP_009299630.1.45394 ENSDARP00000084038 ENSDARP00000084038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]