SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000084850 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000084850
Domain Number 1 Region: 19-143
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.09e-30
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000084850   Gene: ENSDARG00000062481   Transcript: ENSDART00000090417
Sequence length 579
Comment pep:novel chromosome:Zv9:9:25043749:25056698:1 gene:ENSDARG00000062481 transcript:ENSDART00000090417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFKMMPSSSSGKNLDLSRLTDDEAKHVWQVIQRDFHLRKKEEDRLGELKTKIMKEDNKR
ELLEYQPKLSDSLCIRCLQPFKFLVNSKRQCLDCKLFVCKSCSRFNKKDSGWVCDPCHMA
RMLKIGTLEWFHENVRSRFKRFGSAKVMNSLFKRVNSDRACSQTDLREPRDDDTHSMPEV
HTASVYSQEDEQSERTDRRHLSLMRKGRRLLPVHPLDFNLGVENCAYSRPPLLRHSGSQE
KITQTKDSLAEDDWSTTVKQILENGTHGRGNEIKDIMHISQKSLDKASHFDDCTPHLNQR
LAKSCSLSKMSLSSAGSTNYHLQRELSYSLDDSDDDEDDDEEESEMNVIYSHALHREPSP
DEVPPQIIELNKRMSAIESILSRLEQKMTLPIIGGSVEQVEQKAEDLSPADLEELELRKK
LDELTEKISDKGFSSDEEDAIKSPMASPKKSAVYQVSPIRGASAGLVRPDWPLEAEWKAK
PNAHKSLKKQKRVSSFEFSNTTSCELSQLEGKVAMAAASVQSTQSGVTDIQKRIAALSAA
GMTVETSRRREAAMKQDHYGSWSLCETMTEQFQNNDRFT
Download sequence
Identical sequences XP_005167683.1.45394 XP_021334596.1.45394 ENSDARP00000084850 ENSDARP00000084850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]