SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000086789 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000086789
Domain Number 1 Region: 598-660,830-949
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 8-97,127-203
Classification Level Classification E-value
Superfamily RUN domain-like 6.41e-32
Family RUN domain 0.0027
Further Details:      
 
Domain Number 3 Region: 926-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-27
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000086789   Gene: ENSDARG00000063307   Transcript: ENSDART00000092357
Sequence length 1056
Comment pep:known_by_projection chromosome:Zv9:15:19505412:19605469:1 gene:ENSDARG00000063307 transcript:ENSDART00000092357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGSTTDEEFKEKLLWNVKREVKQIMEEAVTKKFVHEDSSHIIALCSSIEACLSHLLKRRA
AGFLRSDKIAALFTKIGKVNTTVSEICRKVQEQLQQQAEITRRTQSTGQESLRRQGSSTG
RAPQPLSAQAIKHIWVRTALFEKVLDKIVQYIVDNASKYYEREALMHDSVFGPILAALLV
GPCALEYTKLKTSDHFWTDPSANELVQRHRIHGAHRGQEVSPGRRPALGIRKRQSSGSMS
EDKFAASAREYVESLHQNSRVHLLYGKNNVLVQPKKDMEVLRGYLSLHQTAETLTLKWTP
NQLINGTLGDCDLEKSIYWDYALTVPLRQIVCIHCHQRPDCGGTLVLVSQDGIQRPPLHF
PPGGHLLAFLSCLETGLLPRGQLEPPLWSQRGKGKVFPKLRKRNSTARLVDQDGDGEDQI
AADYVFRIVYPGHRHDSITINYHHSTGSRAPSLDDDEEEEDRLHAMISMICSRNLTDPNV
MKDHGDLMEMQGFGGSPLSWQQGECTSHMSSCLSCSTGGSNASVELPASCTCMHDRIPLK
MLCQNMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVNHNIVPPDKPCEASGGLSKDVWSK
YQKDCKNYKELELLRLVYYGGVEHEIRKEVWPFLLGHYKFGMDKKNMAQIDEKITARYQQ
VMREWKACEVIVKQREKEMQSAIFAKLSSGSSIDSHVLRLIHRDSTISNEVFMSVDEPDA
GGQDTSCEDSTPTLTTVVTPAMLAPDERPLVEFDSPDSGLPSSRNYSVASGHSQIMSSID
DGQSMEEDTTPTGGLEEQGGRGSLSEDKLCSQLDKLTTTSSSEGTAPSFSSYTIELLDTV
ALNLHRIDKDVQRCDRNYYYFTSSNLEKLRNIMCSYVWEHLEIGYVQGMCDLLAPLMVIL
DDECLAYSCFTQLMRRMSQNFPTGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYF
CYRWFLLDFKRELLYEDVFAVWEVIWVAPRISSKHFVLFIALALVEVYRDIILDNNMDFT
DIIKFFNEMAERHDVQHILRMARELVHKVQTLIENK
Download sequence
Identical sequences E7FBB4
ENSDARP00000086789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]