SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000087334 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000087334
Domain Number 1 Region: 969-1239
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-71
Family Tandem AAA-ATPase domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 718-967
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.75e-55
Family Tandem AAA-ATPase domain 0.0000658
Further Details:      
 
Domain Number 3 Region: 472-519,546-592
Classification Level Classification E-value
Superfamily Chromo domain-like 4.67e-17
Family Chromo domain 0.02
Further Details:      
 
Domain Number 4 Region: 347-421
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.42e-17
Family PHD domain 0.0028
Further Details:      
 
Domain Number 5 Region: 612-685
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000194
Family Chromo domain 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000087334
Domain Number - Region: 168-206
Classification Level Classification E-value
Superfamily HMG-box 0.00223
Family HMG-box 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000087334   Gene: ENSDARG00000025789   Transcript: ENSDART00000092902
Sequence length 1953
Comment pep:known chromosome:Zv9:16:33984642:34012198:-1 gene:ENSDARG00000025789 transcript:ENSDART00000092902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSEDDRDRFEPMGDDIEEQISETDTPKSKKKKKAKKSRESRTSKRQKVIREEIAVSSP
EVMEAIRMAEGEEEEDRVMRSESEGSDYAPSKKKKKRSSSSKDRKKGSAGEKAGGSGGKS
KRKEPEPEEEDDDDDDDGQEPKSSSQLLADWGMKDIDYTFTQEDYNSLTNYKAFSQFVRP
LIAAKNPKIAVSKMMMVLGAKWREFSTNNPMRGSASANAALAAANVAAAVESMVTKVDAG
GGGGPALATAPPTTTAAPVAAPPPPQQPPAVPLRKAKTKEGKGPNARRKTKPTPKPQDKK
SKAKKVAPLKIKLGNFKRKRSSSGEEDDGESDFDSFSVSDGSNSRSSRSKNKKAKSSKKK
KKMDEDADGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMERAPEGTWSCPHCE
KEGIQWEAREESSEGEEENDDGRRDDGDVEEEDDHHMEFCRVCKDGGELLCCDTCPSSYH
LHCLNPPLPDIPNGEWICPRCLSPPLKGKVQKVLTWRWGEAPPPMPVPRPADLPAEAPDP
PPMIGRKEREFFVKWCNKSYWHCSWVQELQLELNCQVMFRNYQRKTDMEEPPNLEMGAEG
DEDKSCKRKNKDPFYARMEDKYGRFGVKIEWLFIHRILNHSVDKKNNVHYLIKWRDLPYD
QSTWESEDMDVPDFETYKQHYWNHRELMLGEEGRPGKKMKKVKVRKTERPPANPVVDPTI
KFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYK
EGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFTFEDNAIRG
GKKASKMKKEAAVKFHVLLTSYELITIDQAILGSIDWACLVVDEAHRLKNNQSKFFRVLN
NYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADIAKEDQIKKLHDML
GPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKYILTRNFEALNTRGGGNQVSLLN
VVMDLKKCCNHPYLFPTAATEAPKMPNGMYDGSALTKASGKLMLLFKMLKKLKEGGHRVL
IFSQMTKMLDLLEDFLENEGYKYERIDGGVTGGMRQEAIDRFNAPGAPQFVFLLSTRAGG
LGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKK
KMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEQLFKDELGEGDNKEEDSSVIHYDDKA
IDRLLDRNQDATEDTELQSMNEYLSSFKVAQYVVKDEDEEEEDVDREIIKQEESVDPDYW
EKLLRHHYEQQQEDLARHLGKGKRPRKPVNYNDCSQEDRGSRRDWQDDQSDNQSDYSVAS
EEGDEDFDERSEAANSRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAV
MRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLS
RQHVLTRIGVMSLIRKKVQEFEHVNGQWSMPWMKELEESKRAAAIAAGEDPKTPSTGTPA
DTQPNTPAPEDLSKTEDIKELEEKTEGDGEKEVKGSRQEDEIIEIPDEGEKSPSSAKKEE
KTDKESEASSEKDGGSRENEKDGEKEKSAESKENMSSDVKADGSDATNSGDSTKTKEESS
EEKMDTSPASDEKKELKDEKDGVKPEDSAKLQNGENAKETSGGGDGVSEEKKKAVKQRFM
FNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIIFHGYARWQDVQNDPR
FAILNEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMA
LNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIAR
IPPVAVRLQMSERSILSRLASRGPEVTQTQAQR
Download sequence
Identical sequences F1RBT2
ENSDARP00000087334 XP_021322613.1.45394 ENSDARP00000087334 ENSDARP00000124629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]