SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089080 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089080
Domain Number 1 Region: 40-136
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.18e-25
Family Supernatant protein factor (SPF), C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089080   Gene: ENSDARG00000017255   Transcript: ENSDART00000098308
Sequence length 226
Comment pep:known chromosome:Zv9:1:59667322:59677129:-1 gene:ENSDARG00000017255 transcript:ENSDART00000098308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDTRRMCASLLGYVTLLFGAVNAFSPADTEFTFLLPAASKECFYQSAVHNGSVEIEYQV
IAGAGMDVDFSVVSPQGIHLISEFRRSDGVHMVEPTEEGDYQICFDNTFSRFSEKMVFFE
VILDHPSNDAGADDEWAGLGEPESILEYKLDDIKESMETVHRRLERSRQMQTFLRAFEAR
DRNLLEDNLWRVSFWSCVNLLVLLSVAFIQVYTLRRLFDDKRRVYT
Download sequence
Identical sequences F1QF76
XP_017211313.1.45394 ENSDARP00000089080 ENSDARP00000089080 ENSDARP00000098435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]