SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089498 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089498
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089498   Gene: ENSDARG00000075546   Transcript: ENSDART00000098728
Sequence length 116
Comment pep:novel chromosome:Zv9:21:1794705:1800202:-1 gene:ENSDARG00000075546 transcript:ENSDART00000098728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANNARERLRVRDINEAFKELGRMCQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNL
NPKAACLKRREEEKVSSDGAPLSLAAAHHAMGEASNPMGQMSKLPEFIKMMSNHFL
Download sequence
Identical sequences ENSDARP00000089498 XP_005173922.1.45394 ENSDARP00000089498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]