SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089635 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089635
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-46
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000372
Further Details:      
 
Domain Number 2 Region: 405-443
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000445
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00061
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000089635
Domain Number - Region: 191-241
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00497
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089635   Gene: ENSDARG00000017105   Transcript: ENSDART00000098865
Sequence length 445
Comment pep:novel chromosome:Zv9:18:39059004:39153445:-1 gene:ENSDARG00000017105 transcript:ENSDART00000098865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSICQARATVMIYDDGSKKWVPAGTGPQAFSRVQIYHNPTNNAFRVVGRKMQTDQQV
VINCPIVKGLKYNQATPNFHQWRDARQVWGLNFGSKEDAALFANGMMHALDVLSSIPDGG
YSARPVSNGPSPEELEQQRRLEQQRLEQQERERLERERQERERQERERQERERQERERQE
RERPVASVVIPPAPPLAPGGPPAPPGPPPPPGPPPSGPPPPPGPPPSGGGAPPPPAPPLP
SSGGSDGGGGPGGGGGLAAALAAAKLRKVPKDDAGGGGGVASAAASVAAPKADSGRNSVS
MPSGGGGGGGGGGGGGGLMGEMSAILARRRKAADKGEKPPPKAEEPANDDSDTQGPGDFR
RPWEKSATMPRTNSAPRSLESPSSSSPLARMKPVSQSAEAESGEGESEMERIKQELLEEV
RKELQKVKNEIIGAFIQELQKRGST
Download sequence
Identical sequences Q1LVK6
7955.ENSDARP00000089635 XP_005173736.1.45394 ENSDARP00000089635 ENSDARP00000089635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]