SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090346 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090346
Domain Number 1 Region: 88-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090346   Gene: ENSDARG00000068761   Transcript: ENSDART00000099572
Sequence length 240
Comment pep:known chromosome:Zv9:25:11382068:11383326:-1 gene:ENSDARG00000068761 transcript:ENSDART00000099572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFNLPPYLLQAAKCKLEPISSADCGYFSACGSLSPSSSIDSGCFSPPWGAGRQLEGPEN
ANVDCLQAKKLKLALPVDSKRRSRSKNPGMKRQSASEREKLRMRDLTKALHHLRSFLPPS
VAPAGQTLTKIETLRLAISYISHLSDQLRQAEVPNYEMCCSAEASDRLQSGLVFENVCMD
GQQGLMQDNVQYCPTLTSFGDSREQMENSFPATSHFRDAQSYMFPCTTMDDASYSHQFYQ
Download sequence
Identical sequences F1QZT9
ENSDARP00000090346 ENSDARP00000090346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]