SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000091164 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000091164
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0034
Further Details:      
 
Domain Number 2 Region: 148-258
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000091164   Gene: ENSDARG00000022187   Transcript: ENSDART00000100391
Sequence length 747
Comment pep:known chromosome:Zv9:4:22708304:22809614:-1 gene:ENSDARG00000022187 transcript:ENSDART00000100391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSWEKYKNSDKLVRRIYKGIPLQLRGQVWCLLLDIPKIKEEKKDFYEKLKIRARGLSP
DVRQIDLDVNRTYRNHIMFMHRYDVKQQDLFHVLTAYSVYNTEVGYCQGMSQITALLLIY
MNEEDAFWALVKLLSGQRHTMHGFFVPGFPKLMRFQEHHDRILQKMMPKLKQHLDNQEVY
TSLYTMKWFFQCFLDRTPFTLTLRIWDIYILEGERVLTAMSYTILKLHKKTLLKLSMEEL
VKFLQVTLSNDFFFEDDFVIEQLQNSMSELRRSKLELPPPGKEDEYPKKPLGQLPPEPPG
LAAAATNHVANGQPVGQTGEGLPPRGPSPAVSVNKRVDSGPVTDGTPERYQDSRPPSSLD
KFHHPDKIERDRRGVYANKERVPVGGKASTQNQANHNSNARSSMRREIGPRWVKPSEGKL
EAVKAAALRESQLSLATGVPPSPSSPTPDEATGAQRRPRSRAFAPGSNRASNASQYDNVP
GPDGEVMEIIELEKPPSRPPSRPFVGPPLRQGSPTRPPSGGTGVSPFRVPKQSMMQSKPE
PRAPLHYPPGMTPVYTPYISETRQEERLYSQSYTEQIYATTGRGSSNPSPEKTVMNNSYL
TYRRPPPDMPPLRVAPAELSSQIDSAGEGVYYLRQPTRLIGSPAYPPTELRYEGNRRREG
WYGDVEAGPPRSPAGVPRSPSFQKAQLSPVHPVQEFNFAQANISDAVLHFRGPYQEHSGR
QQLPPLFGGAHYRQAQEAFAMQESMLL
Download sequence
Identical sequences F1QF05
ENSDARP00000091164 7955.ENSDARP00000091164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]