SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092004 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092004
Domain Number 1 Region: 313-380
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000011
Family Chromo domain 0.0095
Further Details:      
 
Domain Number 2 Region: 78-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000473
Family B-box zinc-binding domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092004   Gene: ENSDARG00000053450   Transcript: ENSDART00000101230
Sequence length 387
Comment pep:novel chromosome:Zv9:2:42396260:42405281:1 gene:ENSDARG00000053450 transcript:ENSDART00000101230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGKNFILTEVVENIRKTKLQAARPAQCYSEPVDVECDVCTGRKYKAVKSCLVCLDSYCQ
IHFDRHEEFHSKKPHIVTDATGRLQEMICPQHEKLLEMYCRTDQRCICMLCLMNEHKIHE
TVLPAEERAEKQKHFKETLKRRMQDGQEECEKLRGVVKSHKRSAQAAVEDTERIFTELIR
SNERTRSEVTQLIRDQEKASVSVAEGRLEQLEQEMNDLNRKNTELVQLSCTDNHIHFLQS
FQSLSVPPGSTDPSSISTHPSFDDLVTVVSELKEKLQQTVKEKKKIMHRKVRYINGIPTP
EHESRNEFLQCKPPPPPRIIRGQPAYTVCQILDSRLIHGSLQYLVDWEGYGPEEQCWVSS
KDILDHKLIRDYHAKKPNCPRKKEEGR
Download sequence
Identical sequences ENSDARP00000092004 ENSDARP00000092004 7955.ENSDARP00000092004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]