SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092351 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092351
Domain Number 1 Region: 30-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 102-143
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000222
Family Hairy Orange domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092351   Gene: ENSDARG00000069675   Transcript: ENSDART00000101578
Sequence length 223
Comment pep:known chromosome:Zv9:15:7103816:7106499:1 gene:ENSDARG00000069675 transcript:ENSDART00000101578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEWNAVYTAQKQMDMTATKLQQNSCQLHISSKEERKLRKPLIERKRRERINLCLDQLRET
VVAVFKPDQSKLEKADILEMTVKHLQNIQSSRVSDPVLNTGARQRYSTGYIQCMQEVHNL
LHSCDWMDKTLGSRLLNHLFKSLPLSAKDCPRLPKTSLTSVPSDHSEYSSFHVDETASPK
PCSSSPFLCKRPNQSQNQHFTPIRMPHDVESSHLSVLQMWRPW
Download sequence
Identical sequences F1Q965
ENSDARP00000092351 7955.ENSDARP00000092351 7955.ENSDARP00000103093 ENSDARP00000092351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]