SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093874 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093874
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Chromo domain-like 7.6e-18
Family Chromo domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093874   Gene: ENSDARG00000070329   Transcript: ENSDART00000103100
Sequence length 361
Comment pep:known chromosome:Zv9:6:19547761:19551086:-1 gene:ENSDARG00000070329 transcript:ENSDART00000103100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAVGERVFAAESIIKRRIRRGHMEYLVKWKGWSPKYSTWEPEENILDPRLFVAFEER
EREREIFGPKKRGPKLKTFLLKAQAKEKAKSYEFRNDSTRGIHVTYSSPEPVVAPRAREG
LRAVVPTIFPPSTVNRGESVRLQSPEPREHHSPHSPRPTDEFSLTPKKRGRKPKLRFTDG
YISNLHPEHVKRAADETMASIPSKMAKLGLGEDDERCPDISGRLKISHKDLDATCSHKQS
NVIPSRSTLHISPQWSLHSSRMEAGLLGHRTNPQSNHFHQKHLKHYSKKRTLEHGDSTSR
QPSLIAKIPVSHIFREPGVEDAWRPSFINVEKVIVTDVTTNFLTVTIKESNTDEGFFKDK
T
Download sequence
Identical sequences A8KC45
ENSDARP00000093874 ENSDARP00000093874 7955.ENSDARP00000093874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]