SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094282 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094282
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily EF-hand 8.29e-52
Family Calmodulin-like 0.000000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094282   Gene: ENSDARG00000070491   Transcript: ENSDART00000103506
Sequence length 191
Comment pep:known chromosome:Zv9:19:31767679:31770350:-1 gene:ENSDARG00000070491 transcript:ENSDART00000103506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKHNSKLAPEVLDDLTKSTEFNEAELKQWYKGFLKDCPSGILNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRME
MLEIIEAIYKMVGTVIMMRMNEDGLTPQQRVDKIFSKMDKDHNDEISLEEFKEAAKSDPS
IVLLLQCDMQK
Download sequence
Identical sequences A3KPW8 W5UD40
7955.ENSDARP00000094282 7955.ENSDARP00000098633 ENSDARP00000094282 NP_001108159.1.45394 XP_005159696.1.45394 XP_017309483.1.5077 XP_017309484.1.5077 XP_019945901.1.63745 XP_020499762.1.8198 ENSDARP00000094282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]