SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094416 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094416
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000051
Family Hairy Orange domain 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094416   Gene: ENSDARG00000070538   Transcript: ENSDART00000103640
Sequence length 317
Comment pep:known chromosome:Zv9:19:33042965:33047694:-1 gene:ENSDARG00000070538 transcript:ENSDART00000103640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNHDFSSSDSELDENIEVEKESADENAGANSPLGSMSPSTTSQVQARKRRRGIIEKRR
RDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMD
YRGLGFRECLAETARYLSIIEGLDNTDPLRIRLVSHLNSYASQREAHSGLGHLAWGSAFG
TPPSHLAHHLLLQQQQQQGAPLARSTSSPPSSNSSSPSSSSPSAPSTEPRLSGTVISEAG
QTGPLRVPPSTSLPPGLTPPTASKLSPPLLTSLSSLSAFPFPLSAFPLLSPSSLGPATPS
SSLGKPYRPWSMEIGAF
Download sequence
Identical sequences B2GNV6 Q8AXV6
NP_997726.1.45394 ENSDARP00000094416 ENSDARP00000094416 7955.ENSDARP00000094416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]