SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095582 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095582
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Chromo domain-like 9.54e-19
Family Chromo domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095582   Gene: ENSDARG00000071051   Transcript: ENSDART00000104812
Sequence length 411
Comment pep:known chromosome:Zv9:22:31649433:31654797:-1 gene:ENSDARG00000071051 transcript:ENSDART00000104812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAAGDRVFAAEAILKSRVRKGHIEYLVKWKGWALKHSTWEPEENILDDRLIKAFEQK
EREQELYGPKKRGPKPKNFVLKARAQSGDRPRSSYTRRTPSCTTAKPPTASSSASSATPQ
PSSSSSHSTAPTPRVHSLAAAHKLKKDIHRCHMMSRRPLPRSDPLANSTGSSSRHPISPF
SETVRILNRRVKPREVKRGRIILNLKVIDKSENGGMTSRRTPQSFAGRAKIPSRNRIIGK
KHGDMPYRPFQHPMKMLGIPMYGQPFGLNPSGGASSMANEGSNTRASHGGGSRCGSQSSA
QRFQYQPTPSPSNSSGSNGSSPSTQKQPTQKEGPTSSAKLTPTESSRSHDTSQPHPKSSS
TPFLPSSPSYSSSPSSSQEDEDLGSLKSATSRGRKQELRHQTQVGRASVCQ
Download sequence
Identical sequences Q6AZW3
NP_001003768.1.45394 ENSDARP00000095582 ENSDARP00000095582 7955.ENSDARP00000095582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]