SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000096116 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000096116
Domain Number 1 Region: 613-777
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.2e-40
Family Ypt/Rab-GAP domain of gyp1p 0.003
Further Details:      
 
Domain Number 2 Region: 753-870
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-24
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 57-146
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-18
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000096116
Domain Number - Region: 373-405
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0955
Family N-terminal coiled coil domain from apc 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000096116   Gene: ENSDARG00000071304   Transcript: ENSDART00000105344
Sequence length 926
Comment pep:known_by_projection chromosome:Zv9:14:6295900:6334071:1 gene:ENSDARG00000071304 transcript:ENSDART00000105344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKGSSSTPPPPELNVYAPDEEADGAWDKQDPQIHAAQPEGPFKGLGGTPTPSSTKLCG
YLNKQGGPLKTWKSRWFAYEEKSCQLFYYRMAHDINSLGKVDLTRATFSYPLRGEEGTFH
IQTPERTVILKAANRDAQMYWLQQLQLKRAQFRDQQAEHQSTPRPDSLTTESTPPANNCP
ANFLPMVKTPSGLVGEEAASLPAPGLNNPLNMSIKHPLIELQNTMHSFRNRQSQEIRQSV
FHIDDPGDTQKTTSPKTSTLVVPATTSYQAPESPVKAKCEDPHQNNISTISQNRKSGKER
SRFLDLKDTSQLQHEKLSLAEEVKAQKELVLLLHKVLEAAQLEKRTCAQFLAAEGEQERM
ELLRHGERRAAELRVQLEALQQENENLRRDLTQRDEHVAELQNSIQLLLQKNQTKQEVIL
KLSEKLTTCGEDQQYTNGLESETFRQMTMENEQLKDDLKAYNIQNQYLNSEIYQLTMLWR
KSSEREKSLIVKCAVLEANNCQMESRYLGILQKLQESQELNPEQREAVNKMLKDAVQADL
NNAIKLNPISDYDEYGFRIAVDYKVEDLKLLAKIQALEFRSQNLLNQEECDGPLLARCAQ
LLFGRPEGELTSSAEMKGLLRTGLPHEYRVRVWRFMIQTRTKSLRERHPDRYHELCEKSR
SSPHLVPRQIQLDLDRTLTSNKHFSPPTSPLIQKLERVLQAFSWHNPTIGYVQGLNRLAA
IALLVLQEEADAFWCLVVIVEHIMPPNYFTKDLVGCQADQRVLKDLMLEKLPRLTAHLEA
LKVDISLITVEWFLVLFVESLPTRILFKVWDALLYEGSKVIFRYALALFKYREEAILKIQ
DSVEMYQYLRIFPNTIADGRKLTSIAFNDMNPLRMRLIQNRRAAHLERLHAEIKELENLQ
KAYKAERVHCKDKKLDSLASDDEEEV
Download sequence
Identical sequences E7F513
XP_689604.6.45394 ENSDARP00000096116 ENSDARP00000096116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]