SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000096314 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000096314
Domain Number 1 Region: 36-133
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-23
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 2 Region: 161-209
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000523
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000096314   Gene: ENSDARG00000026611   Transcript: ENSDART00000037904
Sequence length 210
Comment pep:known chromosome:Zv9:12:37046023:37050248:-1 gene:ENSDARG00000026611 transcript:ENSDART00000037904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSRLDSAMSSSPFEGGVRLPPHRYKTFSSREQYQMVLAAVRKLQESGFYWSTVSGKE
ASTLLSSEPPGTFLVRDSSDHHHFFTLSVKTATGTKNLRIQCDSSSFFLQTDPRSEQVVP
RFDCVLKLIHHYMPSAGTVSSSNAGEGSAYFIYSGGEKIPLELLRPLASSMSSLQHLCRK
TLNGHIDVSTKRDQLPHPLQEFLQEYDAPI
Download sequence
Identical sequences Q6NYJ2
ENSDARP00000096314 ENSDARP00000096314 NP_998469.1.45394 GO.72247 7955.ENSDARP00000096314 7955.ENSDARP00000098011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]