SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099036 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099036
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 1.12e-42
Family RUN domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1234-1344
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.79e-26
Family Supernatant protein factor (SPF), C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1057-1115
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000011
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099036   Gene: ENSDARG00000078022   Transcript: ENSDART00000114182
Sequence length 1347
Comment pep:known_by_projection chromosome:Zv9:2:51329179:51371813:1 gene:ENSDARG00000078022 transcript:ENSDART00000114182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSTVGENQLQRIIRDLHDAVSELSKEHCDTEEPITDDSSSLHKFCFKLEYLLQFDQKER
TTFLGSRKDYWDYFCDCLAKIKGANDGIRFVKSIPELKTSLGKGRAFIRYCLVHQRLADT
LQQCLINLKITSEWYYERSPFLKSHLNIDIINHLYELNEVQFDVASRGYDLDSQWPTFAR
RTLGSAVSPHVWKPPSRCSSVNSLVSSYTQQVQDFLPGQDFGSSLLGDLGELGELTCSTS
EDLRIELDQSELKQQQLQEKIQLLTDEAADLRVVIKDLQEQLLAKGSDQEKAGEQQQEVV
KAVRECTDRLSTTTQGLEALRTSERNLEAKLSVAENWNMELLAKLDGALSEKGQQAANYC
DSAWKIQELLTKLKEAEQERIEAKRESEDRARIAERLSQEIKLQEGKLKEMEGNLDMCRV
TADKERTTATQQADELQMTINRLQGALSLKERETGNLRTQLQDVQKALEAQQDQMEEHMK
KIQEEMQRKSLLEEQLNAKMNELSVSTQKMRQLENHNQRLIVESQSFQAQAKKLEEYKSQ
CTSLMEINAKLIQTVKRNEDSSKELSEIKTTLEKELKTSQASERQLRTRLESAGLTVESQ
NLEECIENGQTDNKDVLEKLNESTTAPQKNKRTTSGLLQEANEYSKTDHVESTTRLALAE
AQLELNMKEVSRLQDEVLELRAQLLVISEERMKIQALQEVTEASREDLRAQTEQLKSQVE
ELNRRHVEELLRCHEREETLGKERDMEAKMRAEIQTSMTSMKEECHALKKHNSTLALENG
EAREALHRANTETAELGVHVCMLTGQNEEAKLRWEELSNKLQELQMEAQEEVKTLSDSME
SLRKDNAGLKEQVKQMEGLQEALQKLQEKLEQAEDEARSLQEIRQREVDTLRSQLSDEAA
HHQSQVQGMSEDMDALRKRLDIEVEKVSSLEAKVLELESLNSGHSQMIEKTTALIGDSET
IIYQKEEQIKNLKVDLSRAEKELALAQQSCQELGVNLSRSAMEKQAVELKMSAELDDLYR
TKKNLEERLIELIREKDALWQKSDALEFEQKRRAEEQTDRDVTHCLSCKSQFSWMLRRYN
CSRFCGRPFCYSCCSFGGKDRCCKSCSTHSERHQQADQGSPSHSTYSPISSPNQTSTPGV
PWILKSPRPDDMAYDIITEDEVNHVHDSDSSSYTTALSPETQQLSSSDVTSTEDSDELIG
SVQDSEICLLKSGERTLSVPFSVDDVMHFGCKSKELFIKSSCYSVILISAAHPGPSIGWT
FFSEPKSIAFSVVYRETTDTPLEQAKVLIPLTRCRSHKETIQGQLKVRNPGQYTLIFDNS
FSRFVSKKVQYKLSIEMPEVCNGSDCS
Download sequence
Identical sequences ENSDARP00000099036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]