SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099080 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099080
Domain Number 1 Region: 37-107
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000099080
Domain Number - Region: 110-132
Classification Level Classification E-value
Superfamily Orange domain-like 0.000955
Family Hairy Orange domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099080   Gene: ENSDARG00000076857   Transcript: ENSDART00000113803
Sequence length 253
Comment pep:known chromosome:Zv9:8:48790624:48791866:-1 gene:ENSDARG00000076857 transcript:ENSDART00000113803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLNSRKSDSPYSSGFFKHTEHLRTMAAASNSAATAKPQNVKKVSKPLMEKKRRARINKCL
NQLKSLLESACSNNIRKRKLEKADILELTVKHLRHLQNTKRGLSKACDSAEYHAGYRSCL
NTVSHYLRASDTDRDSRSIMLTNLTSGLNHNRVPDFSTVESDPALIFTLPSTLRRPHKVP
IRTDVSYSSFQQTAERKVCLMPKRTEIGDSDRMSLDAALRSQESKKAETTHFRPKDLKVI
ECCIFKQNYWRPW
Download sequence
Identical sequences F1RDU0
ENSDARP00000099080 ENSDARP00000099080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]