SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099918 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099918
Domain Number 1 Region: 45-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.89e-42
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 541-646
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000549
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099918   Gene: ENSDARG00000074623   Transcript: ENSDART00000114528
Sequence length 1070
Comment pep:novel chromosome:Zv9:16:27535670:27554417:1 gene:ENSDARG00000074623 transcript:ENSDART00000114528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVTDIGSREDGKIWHRKSVSKNGVLATVIRNSSARQTKTVRFLQVAFDTTGESFLAGDH
HGNIYVFDICRNRFKLVQKTGQACTALAFNLRRTTEFLVALADYSIKCFDKDTRQLVSWM
RGHEGAVSSLSIHSSGSFAISTSSDTAQLWSLDTFQRKRKLNVRQSVGIQKVFFLPHSNT
ILSCFSDNSIFAWETDTLFCKYQLPVPQNGPRIHYRTFAVTQNGKTLAAAGRSNLVHLWC
LDSQQLIRVIQMPSNVKTVRYLDFLPDSFDDGSNQTLGVLSQDGIMRFVNIQSCKQLFLI
GSHEDAISSATVCPKGHHIVAVMDSGAIKIYDVRSLTTEISKPPQPLLKRVTKVNISDGS
CLKMKVNTGAGQRAVKTSGRRIQSKLLPPSVSTLDDKENDLPNGLSKKRLQALLREFGEY
PAKYRMFIWRSLLRLPENHAAFSSLTDKGLHSAFLCLQEQYPIKSHKLQRGLQRVLSALA
HWAAVFGETDYVPLLAFPFVKLFQNNPLICFEAVATVIVNWCQHWFEYFPNPPLNVLSLA
ENVLAHHDKELLQHFVACGVTSQLYAWPLLETLFSEVLMREEWLKLFDNVFSNHPSFLLM
AVVAYVTCCRAPLLLCTDKRDFEYFFHHRNSLDIGAMLKETYRLMDRTPADIHPSSALND
FEPLTQGQYPVFNKYPTFIVEYQSQERERIRQQEVEYLRERQEVQKLHAEAVRQQAEFEA
WYKQQELLLQGEEQRRLILQEEESKLAQQRARLAAMKRELKVKELSLIDSSRRRFLKHQQ
DQRRVHLKRLDDEIQRKMALRDQETAAAVQEVEVRQMELDAQRQLFEQQLAREQERVSQE
VRAEVDTRSRRAEADHYTFQNFILADADISQKNQKMLVEESLAEAGQMEVDADWQAEVIK
RLEEAKERQEKQRERLVNLGKQTRDKEDKVVQLMQEVEGKQWDDIVAKQAEREDKRWAAT
SVTTQPRSFISQETEEIEQHSKPHKTLDDSLNPQKEKRRRSPCSSRGLLYKPTDISSNNQ
SDFSLDRNRGELDSKERELMQEIRELRMKLAARARATDFISASASSIHSH
Download sequence
Identical sequences E7F0J3
ENSDARP00000099918 ENSDARP00000099918 XP_695006.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]