SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100011 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000100011
Domain Number - Region: 355-399
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0343
Family Chromo domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100011   Gene: ENSDARG00000077266   Transcript: ENSDART00000109741
Sequence length 400
Comment pep:novel chromosome:Zv9:4:34276306:34284593:1 gene:ENSDARG00000077266 transcript:ENSDART00000109741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYFINVTLQTVLVDTVFSMKMYFVYDLPERMKKPKQKPCHNCGALNVSNCKTCRNCFAAI
ALKASIMAKQKNIEESSWAANNKKHRNAARVVDSARTAVKKLEMLGYKPLLFISKGFNAE
LITTIGPFGEGPQQKIIDKMASLYEVFIKNFQRFQNLAATDPDVCQNLPSSVSPPASIPP
SSFSSLPPPPSFPNLSPPQTSSSFPPSSAVPPPSFPNLSPPQSSFSFPPSSDVSPPSFPN
LPPPQSSSSFPPSSASPPLSSNLIPPTNSSSFSPPTSSYITPLPPASSYKTLPAPPPTSL
TTTPTSSLSSPAVQCMTTDSGDSADLFSRESIIKGDKQKKWIYKQAECQVHSNQKTFPYD
RIVKRRMSKEGVEEAKVRWKPCSACGMKWKDSWEPLNHFL
Download sequence
Identical sequences ENSDARP00000100011 ENSDARP00000100011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]