SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100319 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100319
Domain Number 1 Region: 51-226
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-42
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 2 Region: 201-323
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100319   Gene: ENSDARG00000077871   Transcript: ENSDART00000109094
Sequence length 470
Comment pep:known chromosome:Zv9:8:42623580:42644723:-1 gene:ENSDARG00000077871 transcript:ENSDART00000109094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEESSFGSDSEINGFTSSRQTDKYGFIGGAQQYSTEMAQDVPLAVLRHREAKWLDMLNHW
DKWISKRFKKVRLRCQKGIPPSLRGRAWLYLSGGKVKREQNVGMFKDLDSMEGDPKWIDV
IERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPDEGYCQAQAPIAAVLLMHMPAE
DAFWGLVQICEKYLPGYYSAGLEAIQLDGLILNALLKRVSPPAYQHLDKHKIEPILYMTE
WFMCAFSRTLPWSSVLRVWDMFLCDGVKIIFRVGLVLLKCMLGTREKLKACPGQYETMEL
LKALEPRYMQEAFLVHQVMEMPISARDVEREHRAQLKRWRKTHGELSYKSPPRMHGAQAI
MSAEPHSRQDLRQKPTIVVEYPLPSDTTSNFARVRRRSTIRKASTKPQPSPIFTHISPPS
QTAADPRPSHPITQEPTSRTEAPSSRTPELFSRTQAPSSRTQTPSSRTQA
Download sequence
Identical sequences ENSDARP00000100319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]