SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101389 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101389
Domain Number 1 Region: 91-155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000642
Family PHD domain 0.0091
Further Details:      
 
Domain Number 2 Region: 181-259
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000192
Family PHD domain 0.011
Further Details:      
 
Domain Number 3 Region: 38-88
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000373
Family Tudor domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000101389
Domain Number - Region: 540-561
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0393
Family Chromo domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101389   Gene: ENSDARG00000078050   Transcript: ENSDART00000113286
Sequence length 563
Comment pep:known chromosome:Zv9:8:12857501:12914333:-1 gene:ENSDARG00000078050 transcript:ENSDART00000113286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLESACRDGYLTAGSESLEPKHLHPNIEKSICDQETSLTVGQYVLCCWSDGLYYLGKIQR
VSTSKQSCFVSFEDNSKFWVLWKDIQHAGIPGEEPKCSVCSDMSLDPGNEILICGKCGVG
FHQLCHLPTVESSADPSPWFCRRCIFALAVRKGGALKKGQLAKDLQAMKQVLTYNPEELE
WDSLHRTNHQQCYCYCGGPGQWYLKMLQCFRCEQWFHEACTQCLQDSMMFGDRFYLFICA
VCNKGVEYIKRLALRWVDVVHLALYNLGVQSKKKYFELEEIVAFINNNWDRFQMGKLSNT
PLPERGQLILDALNNYKSKFLCGKEIKKRKCIFRLRTRVPPNPPSKLYPEKAQKSDAHRG
RKKAVSRSSNSDPAEKRRKKRAKWLLEDAIPNNDLTSSWSTNHHMANIFDFTLDELQSLK
STSSGQTFSLDQDSTDAASTSGSATTSVSYDFRKNVGSRKRKLPTSNYNLLATKRELVER
EPSPINMPGEERNVLMENGIDSHTFESISEDDSSLLHLKSSITSYFGAAGRLTCGEKYQV
LARRITPEGKVQYLVEWEGTTPY
Download sequence
Identical sequences F1Q5P7
XP_005166909.1.45394 7955.ENSDARP00000101389 ENSDARP00000101389 ENSDARP00000101389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]