SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101769 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101769
Domain Number 1 Region: 136-307
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 285-403
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101769   Gene: ENSDARG00000070839   Transcript: ENSDART00000111682
Sequence length 816
Comment pep:known chromosome:Zv9:6:28725747:28776413:-1 gene:ENSDARG00000070839 transcript:ENSDART00000111682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCSFKKNIYFKYLSSPKVATDKVTGKLSSTLSWVKNSVSHTVSQMASQVATPSSLHTTVA
SSTASLSSPSSASPTQLSPDDVELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSS
SASSNLSHLEEDSWILWGRIVNEWEDVRKKKEKQLKELVRKGVPHHFRAIVWQLLCNAQN
LPIKEQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREV
GYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQ
LPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGMAILQ
MNQAELMQLDMEGMLQHFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTK
EMEEQVEIKRLRTENRLLKQRIDTLEKRNLMRNNLLPHKGNPRYTEESILQLERELVQAR
LKEAESQCALKEMQDKILYMEQRNTSLPDENNVVRLQEELIGVKLREAEALTGLKELRQQ
VRDLEEHWQRHLARTAGRWKDSPRKNAASELQDELMSVRLREAEAQAELRETRQRMLELE
TQNQIHSNQLRRAELEARNLQDRLHVLSNQNKMLHSELQETKRKQAEIECKNKEEVMAVR
LREADNIAAMAELQQQISELEIQKEEGKVQGQLNNTDSSQYIRDLKDQIADLKHEIRCLR
GHQGLPNQHTFDGIHIVNHYGGDNESYQSSDEDGVKLSPHLTTHQDRGRITLHPNLEDSE
SEGDEEGDALRLTVPSNVSHKTTTVPERRESLSMSS
Download sequence
Identical sequences ENSDARP00000101769 ENSDARP00000101769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]