SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101873 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101873
Domain Number 1 Region: 20-79
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 89-132
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000196
Family Hairy Orange domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101873   Gene: ENSDARG00000007097   Transcript: ENSDART00000109394
Sequence length 224
Comment pep:known chromosome:Zv9:15:7114862:7117817:1 gene:ENSDARG00000007097 transcript:ENSDART00000109394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHAAELRNNLGVGEYACYGFKGDRKTRKPIVEKKRRARINESLQDLRTLLTNNDSQTKM
ENAEVLELTVKRVESILQSRSQETGAVTQEASERFAAGYIQCMHEVHTFVSTCPGIEARV
AAELLNHLLESMPLNENHLHDMIKDLISEPSSSGDSWQSGEAQNPGRHCVSGMSSELPQF
LSNPFCHDLCSDLDETETEERSASAEDTLDFSMVTHSKFMWRPW
Download sequence
Identical sequences F1QU78
7955.ENSDARP00000012990 ENSDARP00000101873 ENSDARP00000101873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]