SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101937 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101937
Domain Number 1 Region: 455-648
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0047
Further Details:      
 
Domain Number 2 Region: 623-733
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.54e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101937   Gene: ENSDARG00000073771   Transcript: ENSDART00000109305
Sequence length 771
Comment pep:novel chromosome:Zv9:12:6330346:6362174:1 gene:ENSDARG00000073771 transcript:ENSDART00000109305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYSPSGVQKSSVISEHCGYFVDSPVKLMVESSSSGGRGAEEGRPPPRIADVTDRQENIM
QGMFSNSGASQREKGQLQSSQEHEATESCDEVNLPCGAKLPNGHASHNAPERVACKSSSP
AGSCVSSEDDHGIANGELLVDSGSAGDAVSSAFCSGETPDEAGESLETQAGETLEALDQA
ERSSTDHCLGLQSSECNEGKLHRRSSTSPSPLKHSLRTFSSSTFLNTDSASLSPNDDDDE
DETFSTSDRPDDLRFMDVSLKSRNTYEISRRQSAPDNIPGVLSVAAVDLTLGQRKQGISD
IFSRSLFTRKQREAQSAPGWKLFGKVPLRESPPKDSKTIQQESNPGNLTSVSTPNLLSSG
EYEAKVCKSGQSPSLPAQSRRKNLEFEPLSTTALILEDRPANLPAKSEEEAQRHRQEYDE
MVAEAKKRELKEAQKKKKQMKERFKQEESIANAMVVWNTEILPNWESMRGTRRVRDLWWQ
GLPPNVRGKVWSLAVGNELNITSDLYEIFLSRAKERWKSFRETGSEIESDVDSADRESSL
DLIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEE
ADAFIAFANLLNKPCQMAFFRVDHELMLKYFAAFEVFFEENLPRLFNHFKSYNLTPDLYL
IDWIFTLYAKSLPLDVACRVWDVFCRDGEEFLFRTGLGILRLYEELLLQMDFIHSAQFLT
RLPDDTPPERLFSCIASTQMISSNRKWTQVFNALIKDKEMEKSSVPSVKNS
Download sequence
Identical sequences E7FDW4
ENSDARP00000101937 XP_005169505.1.45394 ENSDARP00000101937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]