SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102196 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102196
Domain Number 1 Region: 24-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102196   Gene: ENSDARG00000074897   Transcript: ENSDART00000111075
Sequence length 195
Comment pep:known chromosome:Zv9:8:49077686:49082343:-1 gene:ENSDARG00000074897 transcript:ENSDART00000111075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNIITEAHPHSFGSRMTVAQRKEAHELRKTLKPLMEKRRRARINDSLNHLKTLILPLV
GKDASRYSKLEKADILEMTVRFLRDLPSSSAKGQTDSYKEGYKACLQRISTMLPQSNLET
EAHQRVSEFIQQSMASSSSSCQNCCAQNSKMISQMHQRLVSLRNNNSMENPISTVPAPSQ
PQPAPQAAEDMWRPW
Download sequence
Identical sequences ENSDARP00000102196 XP_021333940.1.45394 ENSDARP00000102196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]