SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102826 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102826
Domain Number 1 Region: 69-271
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-44
Family CRAL/TRIO domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 273-383
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.83e-34
Family Supernatant protein factor (SPF), C-terminal domain 0.0000047
Further Details:      
 
Domain Number 3 Region: 9-68
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.68e-16
Family CRAL/TRIO N-terminal domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102826   Gene: ENSDARG00000074570   Transcript: ENSDART00000115359
Sequence length 387
Comment pep:novel chromosome:Zv9:11:21334779:21347028:-1 gene:ENSDARG00000074570 transcript:ENSDART00000115359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAKTLKYPLFGQFREKLEDVWDQLSNQTDHYLLRWLRARTFNVPKAEAMLRKHLEFRRHM
KLETIIDDWSPPEVLERYVAGGMCGYDREGSPIWFDIIGPLDPKGLLLSASKQDCLRTKI
RDAELLRRECEKQSKKLGKHIESITIIYDCEGLGMKHLWKPAVEMYGEILTMYEENYPES
LKKVLLIKAPFIYPLSYLLWIQIFLLTEKKSKVRFLGTNWKDVLKNYVDADQIPAAYGGS
LTDPDGNPLCTTMLRYGGVVPKSYYVRDSIKVQYEQNITISRGSAHQIEYELLFPNCLLR
WQFASEGSDIGFGLFLKTKGSETKKVEDMQEILRNERYNAHLVPEEGSYTCEEPGIYVVR
FDNSYSVLHSKKVSFTVDVLLPEGKQP
Download sequence
Identical sequences ENSDARP00000102826 ENSDARP00000102826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]