SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102845 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102845
Domain Number 1 Region: 12-174
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-42
Family RUN domain 0.00054
Further Details:      
 
Domain Number 2 Region: 1381-1495
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.36e-30
Family Supernatant protein factor (SPF), C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1176-1250
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.49e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102845   Gene: ENSDARG00000056689   Transcript: ENSDART00000111043
Sequence length 1497
Comment pep:known chromosome:Zv9:23:40266635:40343533:1 gene:ENSDARG00000056689 transcript:ENSDART00000111043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGAAVGDSQIQRIIRDLRDAVSELTKEYKESGEPITDDSSNLHKFSYKLEYLLQFDQK
EKTTFLGSRKDYWDYFSDCLAKIKGANDGIRFVKSISELKTSLGKGRAFIRYSLVHQRLA
DTLQQCLMNSRVTSDWYNPRSPFLKPHLSVDIISYLYELNDVQFDVASRGHDLDAEWPTF
ARRTLGMTSSPSHLWKAPSRSSSINSLASTYSQQHHEFPGSPDFGPGLLSDMSMQNSSIL
NDTSMSAIDELRLELDQSELKQRELIDRIQQLGDEGSELRGVVVELQRQLDVSLAAQGNH
QELQRNLEVLIESEHALSREVEVLRDRETRREVSHKDLQDMLAAAERKNEELMTRLDGVL
DEKGQRAASDFNSAQKIHELLNELKEAEKKRMDALAEGEEKRRHAEHLAEEVKVKDEALK
EAEVKMAAWMEKGEQLQTRAVEQRNFMEKLQGALAVREKETSNLQRQLRDLQNSLENMEK
QANVEKKRMQDDKEELEMKMNGLEGLLQSLRTQLKVKESDLLSSTKRVHFLERESEKLRS
ENQKLEYELENSTKKEAKKIDEYKDSCAKLIEQNTKLLQTVNKNEESKKELLENKSSLES
ELAGLRASEKQLRAQIDDAKVTVDEREQRLREENRNLDESLQKANMQLEESESSIRQKEQ
ENKDLMEVQVTLKSALAAMQKEIRDINNQIGELEKNLGVARCNEANLNAQLKDKATQLED
REKLCEELQGRVEELESRQRDLEVEKTKAERAFVKQTEMIQSLEAQRNLAEKTQLEKSTC
QAKETKEMALKLTLLEDQLGLSAKEVSKLQEEVVNLRAKLHSAVEEKDKTQAKLEVTEAS
CAELRILTEHLKKQAEEQNRLHVSELLQSSEHVDKLTSQLNQETSAHEKTTAALASAKED
LVALKAQNERMVLENAETRESLHRVNTEMAELGMTICKLTAEREEARERWAAEAVRIQEL
QQHGVKETERLNASLVALHQENSSLQEELQQTDKLSETMLELKQLLDKTEGERDAAREEI
TAVKFQMSTESMSLKHQMKSLQEEIDGLKDQLDTERKKKSELEAKLSELEGANVEYSRLI
EEKDSHITYCETLLRESESETQQLQERASRSKEALSDVEKEREELKQKLDQVLMETQNQH
LRMSAELEDLGQTKVNLEERLIELIRDKDALWQKSDALEFEQKLRAEEQWWLVDKEATHC
LGCQGQFTWWLRRHHCRLCGRIFCYYCSNNYVMTKNSKKERCCRECYTQHGAVVERFTKA
ELNSSSDNQPSNTAAQLPPPPYIPTPRVTVTDPGERADDGAFDIITDEEVNQIYDSDSRT
TNGSHEEEGGQTGDNSVSSDVTSEEQEDMISVQDAEITLLKSGELSASVPLDIDEIPHFG
DGSRELFVKSSCYSTIPITVGDRGPIISWVFSSEPKSISFTVVYRETLDTPVEQAKVLIP
LTRCNSHKETIQGQLKVRNAGVYTLIFDNSFSRFLSKKVNYHLTIEKPVIYDGSDFP
Download sequence
Identical sequences A0A0R4IIH4
ENSDARP00000102845 XP_009295365.1.45394 XP_009295366.1.45394 ENSDARP00000102845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]