SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102943 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102943
Domain Number 1 Region: 60-227
Classification Level Classification E-value
Superfamily PR-1-like 1.31e-52
Family PR-1-like 0.00013
Further Details:      
 
Domain Number 2 Region: 297-395
Classification Level Classification E-value
Superfamily LCCL domain 5.1e-29
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 3 Region: 399-504
Classification Level Classification E-value
Superfamily LCCL domain 7.72e-28
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102943   Gene: ENSDARG00000077275   Transcript: ENSDART00000113859
Sequence length 510
Comment pep:known chromosome:Zv9:24:14763404:14788787:1 gene:ENSDARG00000077275 transcript:ENSDART00000113859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMGHYTFALPTGLFLLLVTRTVFAMVLFNATDLGFLLEKYLEDDADDDAGDRVMERQRGK
RAITASDMQAILDLHNKLRGQVYPPASNMEYMVWDNELERSAEEWAETCLWEHGPAGLLP
QIGQNLGVHWGRYRPPTSHVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHYTQLVWA
TSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPPSYGGV
CRENLCYKGDGKNRQSPSEETHERNSIEPEAPHSPGPRLRPPSPTRHPNAVVSKEQMSQT
VTCDTKLRDQCKGTTCNRYECPAGCLDSMVKVVGTVYYDMQSSICRAGIHYGVIDNDGGW
VDVTRQGRKDFFIKSYKNGLQSHGKYQSANAFTVSKVTVKVITCDTTVSVLCPYQKPARH
CPRIYCPRNCLEENSQLSRVIGTRIYSDKSSICRSAIHAGVVSNESGGYIDVMPTDNRKL
YTSSYQNGIVSESLQNPAGGKAFRVFAVIQ
Download sequence
Identical sequences ENSDARP00000102943 ENSDARP00000102943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]