SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103094 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103094
Domain Number 1 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.92e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000537
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103094   Gene: ENSDARG00000079947   Transcript: ENSDART00000114877
Sequence length 334
Comment pep:known chromosome:Zv9:21:15791935:15807562:-1 gene:ENSDARG00000079947 transcript:ENSDART00000114877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKSKKSYNVHRPNDTEQAPQKLPEPEPKTIPALVPLEPKECKSPERPQVDPVTR
PSHRDPYDFIKCEREPDCPIPSLPELPTATRRPFYISEPQLAEFPPYYKSSFGWDHGPAS
YQEFRHMGFSPSLLHHASSLYGAHLKQSAEPQPLDCSTHYSPSSNTYHCITCDKVFSTPH
GLEVHVRRSHSGTRPFECSICRKSFGHAVSLEQHMNVHSQERSFECKMCGKTFKRSSTLS
THLLIHSDTRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSR
KHTGFKPFGCEICSKGFQRKVDLRRHHESQHSLK
Download sequence
Identical sequences E7FBX7
ENSDARP00000103094 ENSDARP00000103094 XP_005161190.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]