SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103136 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103136
Domain Number 1 Region: 79-189
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000051
Family Pentapeptide repeats 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103136   Gene: ENSDARG00000016464   Transcript: ENSDART00000114262
Sequence length 306
Comment pep:known_by_projection chromosome:Zv9:20:35110850:35149622:1 gene:ENSDARG00000016464 transcript:ENSDART00000114262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVEVRLKKLEKLIMDGPSQSSGQCFSMETLLDILVCLYDECSSSPIRREKNVLEFLDWD
GGGIGTGLLQPQSARQCRLQPQSARQCRLQPQSARQCRLQPQSARQCRLQPQSARQCRLQ
PQSARQCRLQPQSARQCRLQPQSARQCRLQPQSARQCRLQPQSARQCRFQPQSARQCRLQ
PQSARQCRLQPQSAVQCQCRLQPQSAVQCQFQSGPWLYRRHSSSSPCRRLPGSSPCRRHP
GSSPCRPHPGSSPCRLQPSCLLSRRLQPSCLLSRRLQPSCLLSRRLQPSCLLSRWPQSSS
LSSRLS
Download sequence
Identical sequences F1QAH8
ENSDARP00000103136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]