SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103831 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103831
Domain Number 1 Region: 494-544
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000402
Family Chromo domain 0.0072
Further Details:      
 
Domain Number 2 Region: 285-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000546
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103831   Gene: ENSDARG00000075916   Transcript: ENSDART00000109334
Sequence length 556
Comment pep:known chromosome:Zv9:1:44372014:44380995:-1 gene:ENSDARG00000075916 transcript:ENSDART00000109334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVEDPLSAKFRTLIERLMVATTSEIVKIFSKVLLETRVEITRSWKEIDLLKQHLEKCEQ
EKREAIIRAQRSDFKREDDEMEVSQFKQSYNSDKPRASGSKARTGKVSKDRCVSVGKTKV
TAQSSKPGSSGKKVKTQKTNSPKTKCTEFVARRKVGRPPKKQKSMSISSHTIPITVDDDD
DDDDDEASASVDFQTTSPKVKEMKKENVTSTPTHPNDANVSRGLRDRQHLGMQRHCLCCS
SDECNKQSSPSKAQHQVPTVYICRKCERRFKTDLQFKSHKCSMPQNCDKCGQVFNTLQGL
FTHRQEVQPPLSCSQCEEKFATLCAWAVHKKIHTNLIIPKEIKSKRFEVRLERISDSQLE
AALCSSGSYLQNNSSKQNSDVQNVNATETNNGSACERGAESTMENLPDSSMTQLSSQSSA
ESLLDSSGGQSSVRKVYAVMSSTSCQIQISKDASGSEPSTACENEKVTDDEKLPSDESGL
YTPPRKRRMAECSHDAYNGVFPVENILRWRNNKGKNEVRVKWLPCTLCGAKFQNTWEPAE
SFPGYLDDKNEEPKKN
Download sequence
Identical sequences B8JHZ5
NP_956106.2.45394 XP_005160119.1.45394 ENSDARP00000103831 ENSDARP00000122243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]