SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104446 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104446
Domain Number 1 Region: 86-279
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.75e-48
Family CRAL/TRIO domain 0.0000329
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.45e-21
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 288-401
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.09e-17
Family Supernatant protein factor (SPF), C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104446   Gene: ENSDARG00000086013   Transcript: ENSDART00000121420
Sequence length 446
Comment pep:known_by_projection scaffold:Zv9:Zv9_NA811:1142:29747:1 gene:ENSDARG00000086013 transcript:ENSDART00000121420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDKLDADYIKRYLGDLTPLQESCLIRLRHWLQETHKGKIPKDEHILRFLRARDFNIDKAR
EILCQSLTWRKQHQVDYLLDTWSSPQVLHDFYTGGWHHHDNDGRPLYILRLGHMDTKGLV
RALGEESLLRHVLSINEEGLRRCEENTKVFGRPISCWTCLVDLEGLNMRHLWRPAVKALL
RIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGSGGLV
DYIDKEVIPDFLGGECMCEVPEGGLVPKSLYRTAEELENDEIRLWTETIYQSASIFKGAP
HEQLIEIIDATSVITWDFDVCKGDVIFNIYHSKQAPQPARKDPLATHGITSPAGNNVQLI
EKTWLLGQDYSMVESSLTCKEGESVQGSHVTRWPGFYILQWKFHSMPACAATNLSRVDDV
LATLQVSSHKCKVMYYTEVLGSEDFR
Download sequence
Identical sequences ENSDARP00000104446 ENSDARP00000104446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]