SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105280 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105280
Domain Number 1 Region: 124-295
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.14e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 2 Region: 273-391
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-31
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105280   Gene: ENSDARG00000052766   Transcript: ENSDART00000125037
Sequence length 707
Comment pep:known_by_projection chromosome:Zv9:1:45673097:45717877:1 gene:ENSDARG00000052766 transcript:ENSDART00000125037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPSSSPEREGGMAGSVQLEDLNSPAGLEIDPPFIGSPVLSPDSSSHDAALSAPAASPA
DSENLSPDELELLAKLEEQNRLLEADSKSMRSMSGSRRNSGSSLVSSSSASSNLSQLEED
TWILWGRIVNEWDEWRRKKDKLLKELIRKGIPHHFRAIVWQLLCNATDMPVKNQYSELLK
MSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGL
LLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEHLLQEQLPELNVHFRSQS
FHTSMYASSWFLTLFLTFLPLPIATRIFDIFMYEGLEIIFRVGIAILQYNQTDLIQLDME
GMSQHFQKVIPHQFDSCPDKLILRAYQVKYNPKRMKKLEKEYTTIKNKEMEEQIEIKRLR
TENRLLKQRIETLEKGQVTRAQEAEENYVIKRELAVVRQQCHTASESLEKAQDTIRELQQ
HKYTEEFVSGLQTQLEQSRLQEAELLGALKEMQDKVLDLEKRNSSLPDEINVAQLQEELK
LVKLREQETLRSFREMQEAVTDLNHCWQHHTSRGGGGGGGGHWKESPKKNAMNELQDKLM
SLRLREAQGQAELKEVKLKNLQLESQNQINGKLLGRHEQESTSLQERLQNALSHNKTLQS
QLNEMKRKQAESDCKSKEEVMAVRLREADSMAAMAELRQKIADLEIQ
Download sequence
Identical sequences A2AW99
ENSDARP00000105280 7955.ENSDARP00000069169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]