SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106064 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106064
Domain Number 1 Region: 120-291
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.15e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 269-387
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106064   Gene: ENSDARG00000070839   Transcript: ENSDART00000124947
Sequence length 778
Comment pep:known chromosome:Zv9:6:28725707:28800269:-1 gene:ENSDARG00000070839 transcript:ENSDART00000124947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVATDKVTGKLSSTLSWVKNSVSHTVSQMASQVATPSSLHTTVASSTASLSSPSSASPTQ
LSPDDVELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWIL
WGRIVNEWEDVRKKKEKQLKELVRKGVPHHFRAIVWQLLCNAQNLPIKEQYSELLKMTSP
CEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQ
MPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTS
MYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGMAILQMNQAELMQLDMEGMLQ
HFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENR
LLKQRIDTLEKKGNPRYTEESILQLERELVQARLKEAESQCALKEMQDKILYMEQRNTSL
PDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHLARTAGRWKDSPRKNA
ASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVL
SNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEEG
KVQGQLNNTDSSQYIRDLKDQIADLKHEIRCLRGHQGLPNQHTFDGIHIVNHYGGDNESY
QSSDEDGVKLSPHLTTHQDRGRITLHPNLEDSESEGDEEGDALRLTVPSNVSHKTTTV
Download sequence
Identical sequences E7FA51
ENSDARP00000106064 XP_021332818.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]