SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106183 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106183
Domain Number 1 Region: 63-233
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0062
Further Details:      
 
Domain Number 2 Region: 213-328
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106183   Gene: ENSDARG00000077666   Transcript: ENSDART00000125975
Sequence length 569
Comment pep:known chromosome:Zv9:2:10501363:10519676:1 gene:ENSDARG00000077666 transcript:ENSDART00000125975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTVSSLSSTPGSELSTDEMKLLAKLEEQNRLLETDSKSLYSVNGVLRNPTSPKTFSLEE
NIWENVINEWEDWSKRKVGQIKVLTRRGVPAHLRAMVWQLLCDSGNVSVRPQYSDLLKSS
SPSETLIHRDLTRTFPHHQLFHNHQSISKETLFNVLKAYSVLDQEIGYCKGSVFIVGLLL
TQMAEEEAFCVFVRLMKDFRMRELYKSSRDELGCCIYQFDSMIKEQLPELHSHFQTQGFQ
TSVFSSSWFYSIFLSSLPISAAMRIFDIFMCEGLEIVFRVGLAVLDMKQTELIKLDNEGM
IIQCLQNLESWESNPDLMIEAAYQIKYNGSQMKQFRKDYEAIKAKELEEQEELKGLCSEN
KHLKHRLAILERVSVLLCIFHVFKSSEERAGENSAEHCQLTKRFKGDAGKHLTVGRGKSQ
VRSVTITKICNSYQWEKCCRENDSVSACADQYVLSKTVLCLARHFRLLMCDRGTGASNSH
IAAPDEHSVLYLRTELISCRLREAEALTELKQLKNHIKDMDEKLQMHTVITVLCGGQQRV
SSTQNDLQVELLSTRLKETLTQAILKESR
Download sequence
Identical sequences ENSDARP00000106183 ENSDARP00000106183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]