SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106489 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106489
Domain Number 1 Region: 76-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106489   Gene: ENSDARG00000016951   Transcript: ENSDART00000002863
Sequence length 208
Comment pep:known chromosome:Zv9:13:25985171:25986281:1 gene:ENSDARG00000016951 transcript:ENSDART00000002863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRSSCALVGRNGTFKSNWSSASEPKFGSTDMTKSQPIKYNREAELASKEWSFTFREDK
TSNRKLKKLMSTSRQRGNRRVKANDRERHRMHNLNSALDNLRSVLPTFPDDAKLTKIETL
RFAHNYIWALSETLRIADHVRQRSNHAQDQENLAVPNACLDVRYGASSACASKWHSTNSS
SNWQETQGFYTDLLLEEFNGNFQDNLTF
Download sequence
Identical sequences B3DFN6
XP_021336166.1.45394 ENSDARP00000106489 ENSDARP00000106489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]