SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107079 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000107079
Domain Number - Region: 50-130
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000432
Family Supernatant protein factor (SPF), C-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107079   Gene: ENSDARG00000088079   Transcript: ENSDART00000126879
Sequence length 240
Comment pep:known_by_projection chromosome:Zv9:25:38300064:38302511:-1 gene:ENSDARG00000088079 transcript:ENSDART00000126879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKSVFSMCCVVFVCVCVSAAPQLSDQELLWGSDQYDFSIMLRAADLQCFWHFAHYGEHF
YLNFMVQLVTGVALDRHLSVMVNAPSGLIVGKVDDASGQIAFSVKETGFYQMCFSNFHNR
FGSMQVFLDFGVYYDGQENAEKRKEDEKKRKEEDLKQINSTLSVIEESSGRLQRFVFHMW
RHYNYERMRRGADFYLLQSNSSYISSWSAAQSLMIISAGVLQLWGIRRLFRRPPAEGAHC
Download sequence
Identical sequences E7F154
ENSDARP00000107079 XP_005163268.1.45394 ENSDARP00000107079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]