SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107162 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107162
Domain Number 1 Region: 398-605
Classification Level Classification E-value
Superfamily PUA domain-like 3.23e-78
Family SRA domain-like 0.00000000651
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.67e-18
Family Ubiquitin-related 0.0000454
Further Details:      
 
Domain Number 3 Region: 695-751
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000979
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 4 Region: 314-368
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000122
Family PHD domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000107162
Domain Number - Region: 136-184
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0494
Family Chromo domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107162   Gene: ENSDARG00000009946   Transcript: ENSDART00000122573
Sequence length 776
Comment pep:known chromosome:Zv9:22:4124042:4154710:1 gene:ENSDARG00000009946 transcript:ENSDART00000122573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTMDGKETHRVDSLSKLTKVDELRVKIAELFNVEPERQRLFYRGKQMEDGHTIFD
YNVGLNDIVQLLVRQAVAATVLPKDKEAELSDSDSGCGSAQSESDKGSTHGESDVQSAGA
SGQTDTADLIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAEDGGAEDIVYHVKY
EDYPENGVVQLRGKDVRPRARTVYQWHQLEPGMIVMVNYNPDDPKERGYWYDAEIQRKRE
TRTQREVFGKILLGDAGDSLNDCRIMFVTEIYKIEEPGSAEGPGASSDSPLKKGSNGPEC
KVCKDDPKKNCRVCNCHVCGIKQDPDKQLLCDECDMAFHTYCLNPPLTTIPDDEDWYCPD
CRNDASEVVLAGEKLKESKKKAKMASASSSSQRDWGKGMACVGRTKQCTIVPSNHYGPVP
GVPVGTLWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDDGNEFTYTGSG
GRDLSGNKRTAEQSCDQKLTNMNRALALNCNAAVNDKEGAEAKDWKAGKPVRVVRSSKGR
KHSKYSPEDGNRYDGIYKVVKYWPEKGKSGFLVWRYLLKRNDEESAPWTRDGKERIKKLG
LTMQYPEGYLEAVAAKEKEKENKNEDDIEETPTKGKRKRKSQSMEEKSSPTKGTPKKMKV
EAYKLSKEQKALIKDDELNKKLWDEAMESLSLGPRFVNKVEEVFLCICCQEVVYQPITTE
CQHNVCRECLQRSFKAKVYTCPACRHDLGKNYQMAVNKPLQAILTQLFPGYSSGRC
Download sequence
Identical sequences E7EZF3
ENSDARP00000104481 ENSDARP00000107162 ENSDARP00000104481 ENSDARP00000107162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]