SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107748 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107748
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily SET domain 0.00000000000114
Family Viral histone H3 Lysine 27 Methyltransferase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107748   Gene: ENSDARG00000089822   Transcript: ENSDART00000129529
Sequence length 125
Comment pep:novel chromosome:Zv9:4:41188660:41189069:1 gene:ENSDARG00000089822 transcript:ENSDART00000129529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAAVVLKQWKPVARLDLVIDSSFVKKIILSQRWKGLTVRPVPDKGDGVFTKRPFQIGEVV
CEYHGELVSHEDGMAIASTSSIRAGHLFFYKNKQHEAMCIDAHEESCQCHPMKQKSQYPA
QAVCP
Download sequence
Identical sequences 7955.ENSDARP00000064012 7955.ENSDARP00000103230 ENSDARP00000107748 ENSDARP00000107748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]