SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108411 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108411
Domain Number 1 Region: 707-989
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-67
Family Tandem AAA-ATPase domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 436-705
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.87e-57
Family Tandem AAA-ATPase domain 0.0000367
Further Details:      
 
Domain Number 3 Region: 270-361
Classification Level Classification E-value
Superfamily Chromo domain-like 5.96e-21
Family Chromo domain 0.0000414
Further Details:      
 
Domain Number 4 Region: 365-453
Classification Level Classification E-value
Superfamily Chromo domain-like 9.62e-19
Family Chromo domain 0.0000657
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000108411
Domain Number - Region: 1264-1295
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00897
Family Homeodomain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108411   Gene: ENSDARG00000060687   Transcript: ENSDART00000127730
Sequence length 1813
Comment pep:known chromosome:Zv9:18:24717169:24772356:-1 gene:ENSDARG00000060687 transcript:ENSDART00000127730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKNKSKKQEDEGSTQSNASSNSASEESNRSGSESGSQSESEQGSEKAQSRHSESNSTSD
SESHSESGSESNGSKSHQSSAQVKDKPVRKKDNLADVKKMWEEHPDVYGVRRSSRSRQEP
ARLNIGAEGSSDSEGESSKRKSSRQKKKENTWKDDDSNDEEDVEEETSSSESEQEEKKVR
SRRLPARRPQTKSSASKQSQKGRKQRKQESSDEDDDDDDDDEEDTPKRQTRRRAATKVSY
KEDQNDFETDSDDLIEMAEGAEEQQDDDSETIEKVVDTRTGKKGATGASTTLYAIEENGD
PGADFDPEKEEGETQFLIKWKGWSYIHNTWESVDSLTQQKVKGMKKLENFKKKNEELNAW
LKKASPEDLEYYNCQQELTNDLSKQFQIIERVIATRTGKSQATSDTPSHKSSSGEPEYLC
KWMGLPYAECTWEDSALIKKKFQACIDSFHNRNSSKTVPSKDCKVLKQRPRFVPLKKQPS
YIGDENLELRDYQLDGVNWLAHSWCRCNSVILADEMGLGKTIQTISFLSYLFHQHQLYGP
FIVVVPLSTLTSWQREFDTWAPDMNVVVYLGDVTSRKTIRDYEWINPQTKRIKFNALLTT
YEILLKDKGVLGNINWAFLGVDEAHRLKNDDSLLYKTLIDFRSNHRLLITGTPLQNSLKE
LWSLLHFLMSDKFESWEDFEDEHGKGRDNGYQSLHKVLEPFLLRRVKKDVEKSLPAKVEQ
ILRVDMSAQQKQFYKWILTRNFKALSKGTRGSSSGFLNIVMELKKCCNHAFLIKQPEDGE
NDAPQEHLQSLVRGGGKLVLLDKLLTRLKDRGNRVLIFSQMVRMLDILADYLSMKRYQFQ
RLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDL
QAQARAHRIGQKKQVNIYRLVTKGTVEEDIIERAKKKMVLDHLVIQRMDTTGRTVLDNSS
ANSNSNPFNKEELSAILKFGAEDLFKEAEGEESEPQEMDIDEILRLAETRESDQGSSATD
ELLSQFKVANFTMDESTPDLDEKPGRDWDEIIPEEQRRKVEEEQKQKEMEDIYMLPRSRS
SNKKAQANDSDSDVGSKLKHRSSGSDSETDDSEDDKRPKRRGRPRARKNNVEGFTDAEIR
RFIKAYKKFGAPLERLEAIARDSELVEKSIADLKRLGELVHNSCVTAVQEHEEHLKENPV
EAKGPGKRRGINIKISGVQVNAKSIIQHEEEFEPLHKAVPSNPAERNKFQLTCRVKTPHF
DVDWDIHDDTQLLLGIYEHGYGNWDLIKTDPDLKLSEKILLDDPEKKPQGKQLQMRTDYL
LKMLKKDLESQDAIKAGDEPKIKKRKPRMKKKAPSNELVNEIASPRLSDNPSEEGEVKDD
GAEKTPTKKKQKKDNKENKEKTGTPKKEKEGDKDKKRSKPKKEKAKPAGKGKKAQGPVHI
TQGSEPIPIGEEDDELDQETFSICKERMRPVKKALKQLDKPDEGLSVQDQLQHTRTCLLK
IGDRITECLKSYSDPEHIKIWRRNLWIFVSKFTEFGAQKLHRLYKKAQKKRSQEGEKEHK
KKDDPIKKKPFRPEPSGSSRDSTGAQPTTKPHPPVSHQSGPPHPPHHREQYNQHNKRHFP
NDDRGDWQRDRKYGYPGNSNQPWQGDRHHPYEPHRYKDHHYSDRRPHGDYRSSGGYRNSG
SPRKRPYDQYGNDRDHRGHRDYYDRHPDPKRRRSDEYRSPNYHQGGGGGGGGGGGGGHPQ
DFRRMPDHRGPPGNHGPMGPDHYRPFHPDKPPPLIDPRSPQSQKSPLEPISPGMDRSAEQ
KSATDFNWNNRKT
Download sequence
Identical sequences E7F7R2
ENSDARP00000108411 ENSDARP00000108411 XP_009291898.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]