SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108453 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108453
Domain Number 1 Region: 397-604
Classification Level Classification E-value
Superfamily PUA domain-like 3.23e-78
Family SRA domain-like 0.00000000651
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.67e-18
Family Ubiquitin-related 0.0000454
Further Details:      
 
Domain Number 3 Region: 694-750
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000979
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000109
Family PHD domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000108453
Domain Number - Region: 136-184
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0494
Family Chromo domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108453   Gene: ENSDARG00000091448   Transcript: ENSDART00000121555
Sequence length 775
Comment pep:known chromosome:Zv9:22:3857038:3887706:1 gene:ENSDARG00000091448 transcript:ENSDART00000121555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTMDGKETHRVDSLSKLTKVDELRVKIAELFNVEPERQRLFYRGKQMEDGHTIFD
YNVGLNDIVQLLVRQAVAATVLPKDKEAELSDSDSGCGSAQSESDKGSTHGESDVQSAGA
SGQTDTADLIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAEDGGAEDIVYHVKY
EDYPENGVVQLRGKDVRPRARTVYQWHQLEPGMIVMVNYNPDDPKERGYWYDAEIQRKRE
TRTQREVFGKILLGDAGDSLNDCRIMFVTEIYKIEEPGSAEGPGASSDSPLKRSNGPECK
VCKDDPKKNCRVCNCHVCGIKQDPDKQLLCDECDMAFHTYCLNPPLTTIPDDEDWYCPDC
RNDASEVVLAGEKLKESKKKAKMASASSSSQRDWGKGMACVGRTKQCTIVPSNHYGPVPG
VPVGTLWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDDGNEFTYTGSGG
RDLSGNKRTAEQSCDQKLTNMNRALALNCNAAVNDKEGAEAKDWKAGKPVRVVRSSKGRK
HSKYSPEDGNRYDGIYKVVKYWPEKGKSGFLVWRYLLKRNDEESAPWTRDGKERIKKLGL
TMQYPEGYLEAVAAKEKEKENKNEDDIEETPTKGKRKRKSQSMEEKSSPTKGTPKKMKVE
AYKLSKEQKALIKDDELNKKLWDEAMESLSLGPRFVNKVEEVFLCICCQEVVYQPITTEC
QHNVCRECLQRSFKAKVYTCPACRHDLGKNYQMAVNKPLQAILTQLFPGYSSGRC
Download sequence
Identical sequences ENSDARP00000018915 ENSDARP00000108453 7955.ENSDARP00000018915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]