SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109033 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109033
Domain Number 1 Region: 490-928
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.12e-162
Family Reverse transcriptase 0.0000251
Further Details:      
 
Domain Number 2 Region: 1063-1221
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.61e-42
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 1330-1418
Classification Level Classification E-value
Superfamily Chromo domain-like 3.51e-19
Family Chromo domain 0.0081
Further Details:      
 
Domain Number 4 Region: 353-446
Classification Level Classification E-value
Superfamily Acid proteases 0.00000731
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 
Domain Number 5 Region: 285-318
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000046
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109033   Gene: ENSDARG00000086495   Transcript: ENSDART00000122176
Sequence length 1427
Comment pep:novel chromosome:Zv9:11:14824620:14828903:-1 gene:ENSDARG00000086495 transcript:ENSDART00000122176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPASTSEIQEILSRSAARLDHQDQQMQVTGQAIQALVNQVSELTTQVQRLSSGLAAGSA
LPPPPVDPPASPVVSQSRSSEPRLPPPQSYAGEPHLCRAFLAKCSLYIALQPSSFPSEQS
KVAFLINLLTGKAALWGTTVWENKSPCCNTFKAFSDELKVVFDQAASGREASRKLAELRQ
GDQSVADYSIEFRTLAAECGWNSEAQWDMFFHGLAEHIKDEIYALELPKTLEGLINLAVR
VDNRLQRRGHYKESRLQRLASQPCVQEVTPTEPEPEPMQMGRFRLSSEERRRRRAGGLCM
YCGVGGHFVALCPAKINKPSMGKSLLVGEIMPRRNSPNMTSLSIKLCFNSISHTCHALID
SGAEGNFIDAKLANSLNIPVSPLSSPIAVHALSGLSLPTITHITAPIKLITSGNHTELIT
FFLTDTIDTSVILGHPWLVLHKPHINWGHNAVFSWSESCHESCLLSACSNVPCSVFQEEQ
VDLSNVPREYHDLKRVFSKSRAASLPPHRPYDCAIDLLPGTSPPKGKLYSLSVPEREAME
KYISDSLAAKIIRPSSSPAGAGFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAF
ERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALV
NDVLRDMIDQFIYVYLDDILIFSHSLQEHVQHVRRVLQRLLENGLYVKAEKCVFHAQSVQ
FLGHIVSVEGMRMDPEKIQAVVNWPTPDSRKALQRFLGFANFYRRFIRNFSQLAAPLTNL
TSSKTPFRWSNAAEAAFSKLKGCFVSAPILIAPDPSRQFVVEVDASEVGVGAILSQRSAL
DGKIHPCAYFSHRLSAAERNYDIGNRELLAVKLALEEWRHWLEGSGVPFIVWTDHKNLEY
IKSAKRLNSRQARWALFFGRFNFSISYRPGSKNIKPDALSRLFDRSDRTSSPDPVLPQRV
FVANISWEIESRVRTALDGVTPPIGCPPSRLFVPEDLRSDVIRWGHSSKVACHPGVSRTL
FVIKQRFWWPVMARDVRDFVLACSVCAASKSSNRPPAGLLQPLSVPSRPWSHISLDFVTG
LPSSNGNTVVLTVVDRFSKAAHFVPLPKLPSARETAVTVIDHVFRIHGLPTDVVSDRGPQ
FVSKFWREFCRLLGATVSLSSGFHPQSNGQTERANQDLERTLRCLVSQNPSSWSQQLSWV
EYAHNSLPVSATGLSPFQCSLGYQPPVFPSLESEVAVPSVHAFVQRCRRTWNRARQTLLQ
VGERTKAKADRHRSKPPVYVVGQKVWLSSKNIPLRTVCNKLAPKFIGPFTVTKIINPVAV
RLKLPPAYRRIHPVFHVSKVKPVFHTAINPHAPVPPPPRLVDGETAYSVKRILDSRWRGR
GFQYLVDWEGYGPEERSWVPAGDILDHSLIDDYNRQVGSSGDARRRP
Download sequence
Identical sequences ENSDARP00000109033 ENSDARP00000109033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]