SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109280 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109280
Domain Number 1 Region: 93-165
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000453
Family PHD domain 0.011
Further Details:      
 
Domain Number 2 Region: 190-268
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000465
Family PHD domain 0.013
Further Details:      
 
Domain Number 3 Region: 46-97
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000391
Family Tudor domain 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109280
Domain Number - Region: 581-602
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00687
Family Chromo domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109280   Gene: ENSDARG00000005590   Transcript: ENSDART00000122709
Sequence length 605
Comment pep:known chromosome:Zv9:2:10395903:10423736:-1 gene:ENSDARG00000005590 transcript:ENSDART00000122709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDSASADNLAAHQNTPNRQHKSPVSLPRFPLKDGLTDTTKLAGKFEEGQDVLARWSDGL
FYLGTISKIDKHKHRCFVIFEDQSKSWVLWKDIQTGDSGGEMLCSICQNESSEPPNEIVI
CDKCGQGYHQLCHAPVIDSSVIDSDDKWLCRQCVFATTTKRGGALKKGPNAKALQEMKQS
LPYALEELMWDQGHKTNIQQCYCYCGGPGDWYLKMLQCNKCKQWFHEACIQCFQKPMLFG
DRFYLFICSVCNSGPEYLKRLPLRWVDVAHLSLYNLSVIHKKKYFDSELELMTYINENWD
RLQLGELAETPRAERYECILEALNNNLDMFMSGKEIKKKKHLFGLRIRFPPAPQSSELLS
DREPEKASHEIKIKGRKATKPPLSSMPVTNGAVKKGKRKYHTHSLETLAKLRRSSELLAQ
NDEKFPTIDNNSLDLMASKSAKSETFLPSSSTSDVESVGATSTSETTSTTLSRQSSLGSP
SGPRTGCFWPTITQPPIKRRRGRPRRALQPPNPEIPPASNTEPQPTTNNIIPEPSALPSC
LYSSMDIMQGLDPNTQLNHLKSSISTYFGAAGRLACGEKYRVLARRITNDGKVEYLVEWE
GVTAS
Download sequence
Identical sequences A8E7I7
7955.ENSDARP00000091407 ENSDARP00000109280 ENSDARP00000109280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]